Lineage for d1lmb3_ (1lmb 3:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 442266Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 442267Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (6 families) (S)
  5. 442288Family a.35.1.2: Phage repressors [47419] (7 proteins)
    consists of different sequence families of HTH repressors of phage origins
  6. 442332Protein lambda C1 repressor, DNA-binding domain [47420] (1 species)
  7. 442333Species Bacteriophage lambda [TaxId:10710] [47421] (4 PDB entries)
  8. 442334Domain d1lmb3_: 1lmb 3: [17023]

Details for d1lmb3_

PDB Entry: 1lmb (more details), 1.8 Å

PDB Description: refined 1.8 angstrom crystal structure of the lambda repressor-operator complex

SCOP Domain Sequences for d1lmb3_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lmb3_ a.35.1.2 (3:) lambda C1 repressor, DNA-binding domain {Bacteriophage lambda}
pltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalnaynaall
akilkvsveefspsiareiyemyeavs

SCOP Domain Coordinates for d1lmb3_:

Click to download the PDB-style file with coordinates for d1lmb3_.
(The format of our PDB-style files is described here.)

Timeline for d1lmb3_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1lmb4_