SCOPe 2.06: Domain d2xm4a_: 2xm4 A:

Lineage for d2xm4a_ (2xm4 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (3 families)
   Heme-containing proteins

5. Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins)
   automatically mapped to Pfam PF01322

6. Protein automated matches [190363] (5 species)
   not a true protein

7. Species Achromobacter xylosoxidans [TaxId:85698] [189489] (28 PDB entries)

8. Domain d2xm4a_: 2xm4 A: [170222]
   automated match to d1e83a_
   complexed with hec

Details for d2xm4a_

PDB Entry: 2xm4, 1.1 Å

PDB Description: cytochrome c prime from alcaligenes xylosoxidans: ferrous r124e variant

PDB Compounds: (A:) cytochrome c'

SCOPe Domain Sequences for d2xm4a_:

Sequence; same for both SEQRES and ATOM records:

>d2xm4a_ a.24.3.2 (A:) automated matches {Achromobacter xylosoxidans [TaxId: 85698]}
efakpedavkyrqsaltlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafg
pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
dayekkk

Timeline for d2xm4a_:

• d2xm4a_ first appeared in SCOPe 2.01
  
• d2xm4a_ appears in SCOPe 2.05
  
• d2xm4a_ appears in SCOPe 2.07
  
• d2xm4a_ appears in the current release, SCOPe 2.08