SCOPe 2.02: Domain d2xlea_: 2xle A:

Lineage for d2xlea_ (2xle A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (2 families)
   Heme-containing proteins

5. Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins)

6. Protein automated matches [190363] (4 species)
   not a true protein

7. Species Achromobacter xylosoxidans [TaxId:85698] [189489] (24 PDB entries)

8. Domain d2xlea_: 2xle A: [170215]
   automated match to d1e83a_
   complexed with hec, no, so4

Details for d2xlea_

PDB Entry: 2xle, 1.12 Å

PDB Description: cytochrome c prime from alcaligenes xylosoxidans: ferrous r124k variant with bound no

PDB Compounds: (A:) cytochrome c'

SCOPe Domain Sequences for d2xlea_:

Sequence; same for both SEQRES and ATOM records:

>d2xlea_ a.24.3.2 (A:) automated matches {Achromobacter xylosoxidans [TaxId: 85698]}
efakpedavkyrqsaltlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafg
pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
daykkkk

Timeline for d2xlea_:

• d2xlea_ first appeared in SCOPe 2.01
  
• d2xlea_ appears in SCOPe 2.03
  
• d2xlea_ appears in the current release, SCOPe 2.08