Lineage for d1au7a2 (1au7 A:5-76)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. Family a.35.1.1: POU-specific domain [47414] (3 proteins)
  6. Protein Pit-1 [47417] (1 species)
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [47418] (1 PDB entry)
  8. Domain d1au7a2: 1au7 A:5-76 [17021]
    Other proteins in same PDB: d1au7a1, d1au7b1
    protein/DNA complex; mutant

Details for d1au7a2

PDB Entry: 1au7 (more details), 2.3 Å

PDB Description: pit-1 mutant/dna complex
PDB Compounds: (A:) protein pit-1

SCOPe Domain Sequences for d1au7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1au7a2 a.35.1.1 (A:5-76) Pit-1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gmraleqfanefkvrriklgytqtnvgealaavhgsefsqtticrfenlqlsfknacklk
ailskwleeaeq

SCOPe Domain Coordinates for d1au7a2 are not available.

Timeline for d1au7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1au7a1
View in 3D
Domains from other chains:
(mouse over for more information)
d1au7b1, d1au7b2