Lineage for d2xlbi_ (2xlb I:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901488Family c.69.1.25: Acetyl xylan esterase-like [82504] (3 proteins)
    Pfam PF05448; AXE1
  6. 2901541Protein automated matches [191114] (2 species)
    not a true protein
  7. 2901542Species Bacillus pumilus [TaxId:1408] [189177] (6 PDB entries)
  8. 2901551Domain d2xlbi_: 2xlb I: [170204]
    automated match to d1odtc_

Details for d2xlbi_

PDB Entry: 2xlb (more details), 1.9 Å

PDB Description: acetyl xylan esterase from bacillus pumilus without ligands
PDB Compounds: (I:) acetyl xylan esterase

SCOPe Domain Sequences for d2xlbi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xlbi_ c.69.1.25 (I:) automated matches {Bacillus pumilus [TaxId: 1408]}
mqlfdlsleelkkykpkktarpdfadfwkksleelrqveaeptlesydypvkgvkvyrlt
yqsfghskiegfyavpdqtgphpalvrfhgynasyddgihdivnwalhgyatfgmlvrgq
ggsedtsvtpgghalgwmtkgilskdtyyyrgvyldavraleviqsfpevdehrigvigg
sqggalaiaaaalsdipkvvvadypylsnferavdvaleqpyleinsyfrrnsdpeveek
afetlsyfdlinlagwvkqptlmaiglidqvtppstvfaaynhletdkelkvyryfghef
ipafqteklsflqkhll

SCOPe Domain Coordinates for d2xlbi_:

Click to download the PDB-style file with coordinates for d2xlbi_.
(The format of our PDB-style files is described here.)

Timeline for d2xlbi_: