Lineage for d1pou__ (1pou -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537254Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 537255Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (8 families) (S)
  5. 537256Family a.35.1.1: POU-specific domain [47414] (3 proteins)
  6. 537261Protein Oct-1 [47415] (1 species)
    canonical 4-helical fold
  7. 537262Species Human (Homo sapiens) [TaxId:9606] [47416] (7 PDB entries)
  8. 537271Domain d1pou__: 1pou - [17020]

Details for d1pou__

PDB Entry: 1pou (more details)

PDB Description: the solution structure of the oct-1 pou-specific domain reveals a striking similarity to the bacteriophage lambda repressor dna-binding domain

SCOP Domain Sequences for d1pou__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pou__ a.35.1.1 (-) Oct-1 {Human (Homo sapiens)}
dleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknmcklk
pllekwlndae

SCOP Domain Coordinates for d1pou__:

Click to download the PDB-style file with coordinates for d1pou__.
(The format of our PDB-style files is described here.)

Timeline for d1pou__: