SCOP 1.69: Domain d1pou__: 1pou -

Lineage for d1pou__ (1pou -)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (6 families)

5. Family a.35.1.1: POU-specific domain [47414] (3 proteins)

6. Protein Oct-1 [47415] (1 species)
   canonical 4-helical fold

7. Species Human (Homo sapiens) [TaxId:9606] [47416] (7 PDB entries)

8. Domain d1pou__: 1pou - [17020]

Details for d1pou__

PDB Entry: 1pou

PDB Description: the solution structure of the oct-1 pou-specific domain reveals a striking similarity to the bacteriophage lambda repressor dna-binding domain

SCOP Domain Sequences for d1pou__:

Sequence; same for both SEQRES and ATOM records:

>d1pou__ a.35.1.1 (-) Oct-1 {Human (Homo sapiens)}
dleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknmcklk
pllekwlndae

Timeline for d1pou__:

• d1pou__ first appeared (with stable ids) in SCOP 1.55
  
• d1pou__ appears in SCOP 1.67
  
• d1pou__ appears in SCOP 1.71
  
• d1pou__ appears in the current release, SCOPe 2.08, called d1poua_