![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.3: Cytochromes [47175] (3 families) ![]() Heme-containing proteins |
![]() | Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins) automatically mapped to Pfam PF01322 |
![]() | Protein automated matches [190363] (5 species) not a true protein |
![]() | Species Achromobacter xylosoxidans [TaxId:85698] [189489] (29 PDB entries) |
![]() | Domain d2xl6a_: 2xl6 A: [170194] automated match to d1e83a_ complexed with hec, no, no3, so4 |
PDB Entry: 2xl6 (more details), 1.07 Å
SCOPe Domain Sequences for d2xl6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xl6a_ a.24.3.2 (A:) automated matches {Achromobacter xylosoxidans [TaxId: 85698]} efakpedavkyrqsaltlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafg pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach dayakk
Timeline for d2xl6a_: