Lineage for d1cqtb2 (1cqt B:505-575)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709318Family a.35.1.1: POU-specific domain [47414] (3 proteins)
  6. 2709323Protein Oct-1 [47415] (1 species)
    canonical 4-helical fold
  7. 2709324Species Human (Homo sapiens) [TaxId:9606] [47416] (7 PDB entries)
  8. 2709331Domain d1cqtb2: 1cqt B:505-575 [17019]
    Other proteins in same PDB: d1cqta1, d1cqtb1
    protein/DNA complex

Details for d1cqtb2

PDB Entry: 1cqt (more details), 3.2 Å

PDB Description: crystal structure of a ternary complex containing an oca-b peptide, the oct-1 pou domain, and an octamer element
PDB Compounds: (B:) pou domain, class 2, transcription factor 1

SCOPe Domain Sequences for d1cqtb2:

Sequence, based on SEQRES records: (download)

>d1cqtb2 a.35.1.1 (B:505-575) Oct-1 {Human (Homo sapiens) [TaxId: 9606]}
dleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknmcklk
pllekwlndae

Sequence, based on observed residues (ATOM records): (download)

>d1cqtb2 a.35.1.1 (B:505-575) Oct-1 {Human (Homo sapiens) [TaxId: 9606]}
dleeleqfaktfkqrriklgftqgdvglamgklyndfsqttisrfealnlsfknmcklkp
llekwlndae

SCOPe Domain Coordinates for d1cqtb2:

Click to download the PDB-style file with coordinates for d1cqtb2.
(The format of our PDB-style files is described here.)

Timeline for d1cqtb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cqtb1