Lineage for d2xkqc_ (2xkq C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314152Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2314869Protein Dodecameric ferritin homolog [47250] (16 species)
  7. 2315165Species Streptococcus suis [TaxId:1307] [101134] (8 PDB entries)
  8. 2315252Domain d2xkqc_: 2xkq C: [170184]
    automated match to d1umng_
    complexed with ca, cl, epe, mn3

Details for d2xkqc_

PDB Entry: 2xkq (more details), 2.4 Å

PDB Description: crystal structure of streptococcus suis dpr with manganese
PDB Compounds: (C:) DNA protection during starvation protein

SCOPe Domain Sequences for d2xkqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xkqc_ a.25.1.1 (C:) Dodecameric ferritin homolog {Streptococcus suis [TaxId: 1307]}
dskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserlitl
ggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegdsv
tndifnvakasiekhiwmlqaelgqapkl

SCOPe Domain Coordinates for d2xkqc_:

Click to download the PDB-style file with coordinates for d2xkqc_.
(The format of our PDB-style files is described here.)

Timeline for d2xkqc_: