SCOPe 2.05: Domain d2xkha_: 2xkh A:

Lineage for d2xkha_ (2xkh A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.4: Nerve tissue mini-hemoglobin (neural globin) [74660] (2 proteins)
   lack the first helix but otherwise is more similar to conventional globins than the truncated ones
   automatically mapped to Pfam PF00042

6. Protein automated matches [191208] (1 species)
   not a true protein

7. Species Milky ribbon worm (Cerebratulus lacteus) [TaxId:6221] [189562] (4 PDB entries)

8. Domain d2xkha_: 2xkh A: [170180]
   automated match to d1kr7a_
   complexed with hem, oxy, so4, xe; mutant

Details for d2xkha_

PDB Entry: 2xkh, 2.31 Å

PDB Description: xe derivative of c.lacteus mini-hb leu86ala mutant

PDB Compounds: (A:) neural hemoglobin

SCOPe Domain Sequences for d2xkha_:

Sequence; same for both SEQRES and ATOM records:

>d2xkha_ a.1.1.4 (A:) automated matches {Milky ribbon worm (Cerebratulus lacteus) [TaxId: 6221]}
mvnwaavvddfyqelfkahpeyqnkfgfkgvalgslkgnaayktqagktvdyinaaiggs
adaaglasrhkgrnvgsaefhnakacaakacsahgapdlghaiddilshl

Timeline for d2xkha_:

• d2xkha_ first appeared in SCOPe 2.01
  
• d2xkha_ appears in SCOPe 2.04
  
• d2xkha_ appears in SCOPe 2.06
  
• d2xkha_ appears in the current release, SCOPe 2.08