Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.4: Nerve tissue mini-hemoglobin (neural globin) [74660] (2 proteins) lack the first helix but otherwise is more similar to conventional globins than the truncated ones |
Protein automated matches [191208] (1 species) not a true protein |
Species Milky ribbon worm (Cerebratulus lacteus) [TaxId:6221] [189562] (2 PDB entries) |
Domain d2xkha_: 2xkh A: [170180] automated match to d1kr7a_ complexed with hem, oxy, so4, xe; mutant |
PDB Entry: 2xkh (more details), 2.31 Å
SCOPe Domain Sequences for d2xkha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xkha_ a.1.1.4 (A:) automated matches {Milky ribbon worm (Cerebratulus lacteus) [TaxId: 6221]} mvnwaavvddfyqelfkahpeyqnkfgfkgvalgslkgnaayktqagktvdyinaaiggs adaaglasrhkgrnvgsaefhnakacaakacsahgapdlghaiddilshl
Timeline for d2xkha_: