Lineage for d2xkha_ (2xkh A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2689373Family a.1.1.4: Nerve tissue mini-hemoglobin (neural globin) [74660] (2 proteins)
    lack the first helix but otherwise is more similar to conventional globins than the truncated ones
    automatically mapped to Pfam PF00042
  6. 2689389Protein automated matches [191208] (1 species)
    not a true protein
  7. 2689390Species Milky ribbon worm (Cerebratulus lacteus) [TaxId:6221] [189562] (4 PDB entries)
  8. 2689394Domain d2xkha_: 2xkh A: [170180]
    automated match to d1kr7a_
    complexed with hem, oxy, so4, xe; mutant

Details for d2xkha_

PDB Entry: 2xkh (more details), 2.31 Å

PDB Description: xe derivative of c.lacteus mini-hb leu86ala mutant
PDB Compounds: (A:) neural hemoglobin

SCOPe Domain Sequences for d2xkha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xkha_ a.1.1.4 (A:) automated matches {Milky ribbon worm (Cerebratulus lacteus) [TaxId: 6221]}
mvnwaavvddfyqelfkahpeyqnkfgfkgvalgslkgnaayktqagktvdyinaaiggs
adaaglasrhkgrnvgsaefhnakacaakacsahgapdlghaiddilshl

SCOPe Domain Coordinates for d2xkha_:

Click to download the PDB-style file with coordinates for d2xkha_.
(The format of our PDB-style files is described here.)

Timeline for d2xkha_: