SCOPe 2.06: Domain d2xk6a1: 2xk6 A:4-271

Lineage for d2xk6a1 (2xk6 A:4-271)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (653 PDB entries)

8. Domain d2xk6a1: 2xk6 A:4-271 [170172]
   Other proteins in same PDB: d2xk6a2
   automated match to d2java1
   complexed with cl, eqh

Details for d2xk6a1

PDB Entry: 2xk6, 2.2 Å

PDB Description: structure of nek2 bound to aminopyrazine compound 36

PDB Compounds: (A:) serine/threonine-protein kinase nek2

SCOPe Domain Sequences for d2xk6a1:

Sequence, based on SEQRES records:

>d2xk6a1 d.144.1.7 (A:4-271) automated matches {Human (Homo sapiens) [TaxId: 9606]}
raedyevlytigtgsygrcqkirrksdgkilvwkeldygsmteaekqmlvsevnllrelk
hpnivryydriidrtnttlyivmeyceggdlasvitkgtkerqyldeefvlrvmtqltla
lkechrrsdgghtvlhrdlkpanvfldgkqnvklgdfglarilnhdtsfaktfvgtpyym
speqmnrmsyneksdiwslgcllyelcalmppftafsqkelagkiregkfrripyrysde
lneiitrmlnlkdyhrpsveeilenpli

Sequence, based on observed residues (ATOM records):

>d2xk6a1 d.144.1.7 (A:4-271) automated matches {Human (Homo sapiens) [TaxId: 9606]}
raedyevlytigrcqkirrksdgkilvwkeldygsmteaekqmlvsevnllrelkhpniv
ryydriidrtnttlyivmeyceggdlasvitkgtkerqyldeefvlrvmtqltlalkech
rrsrdlkpanvfldgkqnvklgdvgtpyymspeqmnrneksdiwslgcllyelcalmppf
tafsqkelagkiregkfrripyrysdelneiitrmlnlkdyhrpsveeilenpli

Timeline for d2xk6a1:

• d2xk6a1 first appeared in SCOPe 2.01, called d2xk6a_
  
• d2xk6a1 was called d2xk6a_ in SCOPe 2.05
  
• d2xk6a1 appears in SCOPe 2.07
  
• d2xk6a1 appears in the current release, SCOPe 2.08