Lineage for d1octc2 (1oct C:5-75)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 152229Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
  4. 152230Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) (S)
  5. 152231Family a.35.1.1: POU-specific domain [47414] (2 proteins)
  6. 152232Protein Oct-1 [47415] (1 species)
  7. 152233Species Human (Homo sapiens) [TaxId:9606] [47416] (5 PDB entries)
  8. 152237Domain d1octc2: 1oct C:5-75 [17017]
    Other proteins in same PDB: d1octc1

Details for d1octc2

PDB Entry: 1oct (more details), 3 Å

PDB Description: crystal structure of the oct-1 pou domain bound to an octamer site: dna recognition with tethered dna-binding modules

SCOP Domain Sequences for d1octc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1octc2 a.35.1.1 (C:5-75) Oct-1 {Human (Homo sapiens)}
dleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknmcklk
pllekwlndae

SCOP Domain Coordinates for d1octc2:

Click to download the PDB-style file with coordinates for d1octc2.
(The format of our PDB-style files is described here.)

Timeline for d1octc2:

152237
d1octc2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1octc1