Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d2xjok_ (2xjo K:)

  1. Root: SCOP 1.75B
  2. Class a: All alpha proteins [46456] (284 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.1: Ferritin [47241] (10 protein domains)
  6. Protein Dodecameric ferritin homolog [47250] (14 species)
  7. Species Streptococcus suis [TaxId:1307] [101134] (8 PDB entries)
  8. Domain d2xjok_: 2xjo K: [170168]
    automated match to d1umng_
    complexed with ca, cl, epe, ni

Details for d2xjok_

PDB Entry: 2xjo (more details)
PDB Description: crystal structure of streptococcus suis dpr with nickel
PDB Compounds: (K:) DNA protection during starvation protein

SCOP Domain Sequences for d2xjok_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xjok_ a.25.1.1 (K:) Dodecameric ferritin homolog {Streptococcus suis [TaxId: 1307]}
sladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserl
itlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeeg
dsvtndifnvakasiekhiwmlqaelgqapkl

SCOP Domain Coordinates for d2xjok_:

Click to download the PDB-style file with coordinates for d2xjok_.
(The format of our PDB-style files is described here.)

Timeline for d2xjok_:

d2xjok_ appears in SCOP 1.75A


d2xjok_
(click for larger image)


d2xjok_ in context of chain



d2xjok_ in context of PDB
Domains from other chains:
d2xjoa_, d2xjob_, d2xjoc_, d2xjod_, d2xjoe_, d2xjof_, d2xjog_, d2xjoh_, d2xjoi_, d2xjoj_, d2xjol_

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu