Lineage for d2xjod_ (2xjo D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2701715Protein Dodecameric ferritin homolog [47250] (16 species)
  7. 2702018Species Streptococcus suis [TaxId:1307] [101134] (8 PDB entries)
  8. 2702070Domain d2xjod_: 2xjo D: [170161]
    automated match to d1umng_
    complexed with ca, cl, epe, ni

Details for d2xjod_

PDB Entry: 2xjo (more details), 2.1 Å

PDB Description: crystal structure of streptococcus suis dpr with nickel
PDB Compounds: (D:) DNA protection during starvation protein

SCOPe Domain Sequences for d2xjod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xjod_ a.25.1.1 (D:) Dodecameric ferritin homolog {Streptococcus suis [TaxId: 1307]}
sladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserl
itlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeeg
dsvtndifnvakasiekhiwmlqaelgqapkl

SCOPe Domain Coordinates for d2xjod_:

Click to download the PDB-style file with coordinates for d2xjod_.
(The format of our PDB-style files is described here.)

Timeline for d2xjod_: