Lineage for d2xjnf_ (2xjn F:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1484437Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1484438Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1484439Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1484862Protein Dodecameric ferritin homolog [47250] (14 species)
  7. 1485094Species Streptococcus suis [TaxId:1307] [101134] (8 PDB entries)
  8. 1485124Domain d2xjnf_: 2xjn F: [170151]
    automated match to d1umng_
    complexed with ca, cl, cu, epe

Details for d2xjnf_

PDB Entry: 2xjn (more details), 2.1 Å

PDB Description: crystal structure of streptococcus suis dpr with copper
PDB Compounds: (F:) DNA protection during starvation protein

SCOPe Domain Sequences for d2xjnf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xjnf_ a.25.1.1 (F:) Dodecameric ferritin homolog {Streptococcus suis [TaxId: 1307]}
ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
svtndifnvakasiekhiwmlqaelgqapkl

SCOPe Domain Coordinates for d2xjnf_:

Click to download the PDB-style file with coordinates for d2xjnf_.
(The format of our PDB-style files is described here.)

Timeline for d2xjnf_: