Lineage for d2xj8a1 (2xj8 A:4-294)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2719959Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2720315Protein automated matches [190089] (9 species)
    not a true protein
  7. 2720316Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188305] (23 PDB entries)
  8. 2720334Domain d2xj8a1: 2xj8 A:4-294 [170131]
    Other proteins in same PDB: d2xj8a2
    automated match to d1ebea_
    complexed with hem, mpd

Details for d2xj8a1

PDB Entry: 2xj8 (more details), 1.69 Å

PDB Description: the structure of ferrous cytochrome c peroxidase
PDB Compounds: (A:) Cytochrome c peroxidase, mitochondrial

SCOPe Domain Sequences for d2xj8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xj8a1 a.93.1.1 (A:4-294) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d2xj8a1:

Click to download the PDB-style file with coordinates for d2xj8a1.
(The format of our PDB-style files is described here.)

Timeline for d2xj8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2xj8a2