![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
![]() | Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
![]() | Family a.35.1.3: SinR domain-like [47432] (9 proteins) |
![]() | Protein automated matches [190827] (2 species) not a true protein |
![]() | Species Enterococcus faecalis [TaxId:1351] [189639] (2 PDB entries) |
![]() | Domain d2xj3b_: 2xj3 B: [170128] automated match to d1utxa_ complexed with gol; mutant |
PDB Entry: 2xj3 (more details), 1.23 Å
SCOPe Domain Sequences for d2xj3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xj3b_ a.35.1.3 (B:) automated matches {Enterococcus faecalis [TaxId: 1351]} miinnlklirekkkisqselaallevsrqtingieknkynpslqlalkiayylncpledi fqwqpe
Timeline for d2xj3b_: