Lineage for d2xj3b_ (2xj3 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709414Family a.35.1.3: SinR domain-like [47432] (9 proteins)
  6. 2709500Protein automated matches [190827] (2 species)
    not a true protein
  7. 2709503Species Enterococcus faecalis [TaxId:1351] [189639] (2 PDB entries)
  8. 2709505Domain d2xj3b_: 2xj3 B: [170128]
    automated match to d1utxa_
    complexed with gol; mutant

Details for d2xj3b_

PDB Entry: 2xj3 (more details), 1.23 Å

PDB Description: high resolution structure of the t55c mutant of cylr2.
PDB Compounds: (B:) cylr2 synonym cytolysin repressor 2

SCOPe Domain Sequences for d2xj3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xj3b_ a.35.1.3 (B:) automated matches {Enterococcus faecalis [TaxId: 1351]}
miinnlklirekkkisqselaallevsrqtingieknkynpslqlalkiayylncpledi
fqwqpe

SCOPe Domain Coordinates for d2xj3b_:

Click to download the PDB-style file with coordinates for d2xj3b_.
(The format of our PDB-style files is described here.)

Timeline for d2xj3b_: