SCOPe 2.07: Domain d2xj3a_: 2xj3 A:

Lineage for d2xj3a_ (2xj3 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.3: SinR domain-like [47432] (9 proteins)

6. Protein automated matches [190827] (2 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:1351] [189639] (2 PDB entries)

8. Domain d2xj3a_: 2xj3 A: [170127]
   automated match to d1utxa_
   complexed with gol; mutant

Details for d2xj3a_

PDB Entry: 2xj3, 1.23 Å

PDB Description: high resolution structure of the t55c mutant of cylr2.

PDB Compounds: (A:) cylr2 synonym cytolysin repressor 2

SCOPe Domain Sequences for d2xj3a_:

Sequence; same for both SEQRES and ATOM records:

>d2xj3a_ a.35.1.3 (A:) automated matches {Enterococcus faecalis [TaxId: 1351]}
miinnlklirekkkisqselaallevsrqtingieknkynpslqlalkiayylncpledi
fqwqpe

Timeline for d2xj3a_:

• d2xj3a_ first appeared in SCOPe 2.01
  
• d2xj3a_ appears in SCOPe 2.06
  
• d2xj3a_ appears in the current release, SCOPe 2.08