Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein automated matches [190091] (13 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188447] (490 PDB entries) |
Domain d2xixa_: 2xix A: [170122] automated match to d1xqza_ complexed with xix |
PDB Entry: 2xix (more details), 2.4 Å
SCOPe Domain Sequences for d2xixa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xixa_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla lrpsdrptfeeiqnhpwmqdvllpqetaeihlhs
Timeline for d2xixa_: