Lineage for d2xiub_ (2xiu B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709414Family a.35.1.3: SinR domain-like [47432] (9 proteins)
  6. 2709500Protein automated matches [190827] (2 species)
    not a true protein
  7. 2709503Species Enterococcus faecalis [TaxId:1351] [189639] (2 PDB entries)
  8. 2709507Domain d2xiub_: 2xiu B: [170121]
    automated match to d1utxa_
    complexed with gol, mtn

Details for d2xiub_

PDB Entry: 2xiu (more details), 1.5 Å

PDB Description: high resolution structure of mtsl-tagged cylr2.
PDB Compounds: (B:) cylr2

SCOPe Domain Sequences for d2xiub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xiub_ a.35.1.3 (B:) automated matches {Enterococcus faecalis [TaxId: 1351]}
miinnlklirekkkisqselaallevsrqtingieknkynpslqlalkiayylncpledi
fqwqp

SCOPe Domain Coordinates for d2xiub_:

Click to download the PDB-style file with coordinates for d2xiub_.
(The format of our PDB-style files is described here.)

Timeline for d2xiub_: