SCOPe 2.08: Domain d2xiua_: 2xiu A:

Lineage for d2xiua_ (2xiu A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.3: SinR domain-like [47432] (9 proteins)

6. Protein automated matches [190827] (2 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:1351] [189639] (2 PDB entries)

8. Domain d2xiua_: 2xiu A: [170120]
   automated match to d1utxa_
   complexed with gol, mtn

Details for d2xiua_

PDB Entry: 2xiu, 1.5 Å

PDB Description: high resolution structure of mtsl-tagged cylr2.

PDB Compounds: (A:) cylr2

SCOPe Domain Sequences for d2xiua_:

Sequence; same for both SEQRES and ATOM records:

>d2xiua_ a.35.1.3 (A:) automated matches {Enterococcus faecalis [TaxId: 1351]}
miinnlklirekkkisqselaallevsrqtingieknkynpslqlalkiayylncpledi
fqwqpe

Timeline for d2xiua_:

• d2xiua_ first appeared in SCOPe 2.01
  
• d2xiua_ appears in SCOPe 2.07