Lineage for d2xiua_ (2xiu A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2318756Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2318757Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2318854Family a.35.1.3: SinR domain-like [47432] (9 protein domains)
  6. 2318938Protein automated matches [190827] (2 species)
    not a true protein
  7. 2318941Species Enterococcus faecalis [TaxId:1351] [189639] (2 PDB entries)
  8. 2318944Domain d2xiua_: 2xiu A: [170120]
    automated match to d1utxa_
    complexed with gol, mtn

Details for d2xiua_

PDB Entry: 2xiu (more details), 1.5 Å

PDB Description: high resolution structure of mtsl-tagged cylr2.
PDB Compounds: (A:) cylr2

SCOPe Domain Sequences for d2xiua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xiua_ a.35.1.3 (A:) automated matches {Enterococcus faecalis [TaxId: 1351]}
miinnlklirekkkisqselaallevsrqtingieknkynpslqlalkiayylncpledi
fqwqpe

SCOPe Domain Coordinates for d2xiua_:

Click to download the PDB-style file with coordinates for d2xiua_.
(The format of our PDB-style files is described here.)

Timeline for d2xiua_: