Lineage for d2xila_ (2xil A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1741311Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1741312Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 1741313Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 1741620Protein automated matches [190089] (9 species)
    not a true protein
  7. 1741621Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188305] (24 PDB entries)
  8. 1741636Domain d2xila_: 2xil A: [170119]
    automated match to d1koka_
    complexed with hem, mpd, mrd, po4

Details for d2xila_

PDB Entry: 2xil (more details), 1.68 Å

PDB Description: the structure of cytochrome c peroxidase compound i
PDB Compounds: (A:) Cytochrome c peroxidase, mitochondrial

SCOPe Domain Sequences for d2xila_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xila_ a.93.1.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ktlvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhd
ntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqg
pkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkth
lknsgyegpwgaannvftnefylnllnenwklekndanneqwdsksgymmlptdysliqd
pkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d2xila_:

Click to download the PDB-style file with coordinates for d2xila_.
(The format of our PDB-style files is described here.)

Timeline for d2xila_: