SCOPe 2.07: Domain d2xila1: 2xil A:4-294

Lineage for d2xila1 (2xil A:4-294)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 protein domains)

6. Protein automated matches [190089] (8 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188305] (24 PDB entries)

8. Domain d2xila1: 2xil A:4-294 [170119]
   Other proteins in same PDB: d2xila2
   automated match to d1koka_
   complexed with hem, mpd, mrd, po4

Details for d2xila1

PDB Entry: 2xil, 1.68 Å

PDB Description: the structure of cytochrome c peroxidase compound i

PDB Compounds: (A:) Cytochrome c peroxidase, mitochondrial

SCOPe Domain Sequences for d2xila1:

Sequence; same for both SEQRES and ATOM records:

>d2xila1 a.93.1.1 (A:4-294) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpwgaannvftnefylnllnenwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

Timeline for d2xila1:

• d2xila1 first appeared in SCOPe 2.01, called d2xila_
  
• d2xila1 appears in SCOPe 2.06