Lineage for d2xigb_ (2xig B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1478534Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1479947Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1479948Protein automated matches [190154] (52 species)
    not a true protein
  7. 1480062Species Helicobacter pylori [TaxId:85962] [189614] (1 PDB entry)
  8. 1480064Domain d2xigb_: 2xig B: [170115]
    automated match to d1mzba_
    complexed with cit, zn

Details for d2xigb_

PDB Entry: 2xig (more details), 1.85 Å

PDB Description: the structure of the helicobacter pylori ferric uptake regulator fur reveals three functional metal binding sites
PDB Compounds: (B:) ferric uptake regulation protein

SCOPe Domain Sequences for d2xigb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xigb_ a.4.5.0 (B:) automated matches {Helicobacter pylori [TaxId: 85962]}
mkrletlesilerlrmsikknglknskqreevvsvlyrsgthlspeeithsirqkdknts
issvyrilnflekenfisvletsksgrryeiaakehhdhiiclhcgkiiefadpeienrq
nevvkkyqaklishdmkmfvwckecqes

SCOPe Domain Coordinates for d2xigb_:

Click to download the PDB-style file with coordinates for d2xigb_.
(The format of our PDB-style files is described here.)

Timeline for d2xigb_: