Lineage for d2xifa_ (2xif A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328246Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2328247Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2328248Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2328588Protein automated matches [190089] (8 species)
    not a true protein
  7. 2328637Species Soybean (Glycine max) [TaxId:3847] [187116] (17 PDB entries)
  8. 2328641Domain d2xifa_: 2xif A: [170113]
    automated match to d1oafa_
    complexed with hem, k, so4

Details for d2xifa_

PDB Entry: 2xif (more details), 1.65 Å

PDB Description: the structure of ascorbate peroxidase compound ii
PDB Compounds: (A:) ascorbate peroxidase

SCOPe Domain Sequences for d2xifa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xifa_ a.93.1.1 (A:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
gksyptvsadyqkavekakkklrgfiaekrcaplmlrlawhsagtfdkgtktggpfgtik
hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred
kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts
nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk
lselgfada

SCOPe Domain Coordinates for d2xifa_:

Click to download the PDB-style file with coordinates for d2xifa_.
(The format of our PDB-style files is described here.)

Timeline for d2xifa_: