SCOPe 2.05: Domain d2xi8a_: 2xi8 A:

Lineage for d2xi8a_ (2xi8 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.3: SinR domain-like [47432] (9 proteins)

6. Protein Putative transcription regulator CylR2 [109811] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [109812] (10 PDB entries)
   Uniprot Q8VL32

8. Domain d2xi8a_: 2xi8 A: [170111]
   automated match to d1utxa_
   complexed with gol

Details for d2xi8a_

PDB Entry: 2xi8, 1.21 Å

PDB Description: high resolution structure of native cylr2

PDB Compounds: (A:) putative transcription regulator

SCOPe Domain Sequences for d2xi8a_:

Sequence; same for both SEQRES and ATOM records:

>d2xi8a_ a.35.1.3 (A:) Putative transcription regulator CylR2 {Enterococcus faecalis [TaxId: 1351]}
miinnlklirekkkisqselaallevsrqtingieknkynpslqlalkiayylntpledi
fqwqpe

Timeline for d2xi8a_:

• d2xi8a_ first appeared in SCOPe 2.01
  
• d2xi8a_ appears in SCOPe 2.04
  
• d2xi8a_ appears in SCOPe 2.06
  
• d2xi8a_ appears in the current release, SCOPe 2.08