![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
![]() | Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) ![]() |
![]() | Family a.123.1.0: automated matches [191623] (1 protein) not a true family |
![]() | Protein automated matches [191142] (5 species) not a true protein |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [189702] (2 PDB entries) |
![]() | Domain d2xhsa1: 2xhs A:790-1026 [170097] Other proteins in same PDB: d2xhsa2 automated match to d1pk5a_ |
PDB Entry: 2xhs (more details), 2.8 Å
SCOPe Domain Sequences for d2xhsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xhsa1 a.123.1.0 (A:790-1026) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} plrvspmirefvqsiddrewqtqlfallqkqtynqvevdlfelmckvldqnlfsqvdwar ntvffkdlkvddqmkllqhswsdmlvldhlhhrihnglpdetqlnngqvfnlmslgllgv pqlgdyfnelqnklqdlkfdmgdyvcmkflillnpsvrgivnrktvseghdnvqaalldy tltcypsvndkfrglvnilpeihamavrgedhlytkhcagsaptqtllmemlhakrk
Timeline for d2xhsa1: