SCOPe 2.08: Domain d2xhsa1: 2xhs A:790-1026

Lineage for d2xhsa1 (2xhs A:790-1026)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.0: automated matches [191623] (1 protein)
   not a true family

6. Protein automated matches [191142] (5 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [189702] (2 PDB entries)

8. Domain d2xhsa1: 2xhs A:790-1026 [170097]
   Other proteins in same PDB: d2xhsa2
   automated match to d1pk5a_

Details for d2xhsa1

PDB Entry: 2xhs, 2.8 Å

PDB Description: crystal structure of the ligand binding domain of fushi tarazu factor 1 of drosophila melanogaster.

PDB Compounds: (A:) nuclear hormone receptor ftz-f1

SCOPe Domain Sequences for d2xhsa1:

Sequence; same for both SEQRES and ATOM records:

>d2xhsa1 a.123.1.0 (A:790-1026) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
plrvspmirefvqsiddrewqtqlfallqkqtynqvevdlfelmckvldqnlfsqvdwar
ntvffkdlkvddqmkllqhswsdmlvldhlhhrihnglpdetqlnngqvfnlmslgllgv
pqlgdyfnelqnklqdlkfdmgdyvcmkflillnpsvrgivnrktvseghdnvqaalldy
tltcypsvndkfrglvnilpeihamavrgedhlytkhcagsaptqtllmemlhakrk

Timeline for d2xhsa1:

• d2xhsa1 first appeared in SCOPe 2.01, called d2xhsa_
  
• d2xhsa1 appears in SCOPe 2.07