SCOPe 2.01: Domain d2xhfb_: 2xhf B:

Lineage for d2xhfb_ (2xhf B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (35 species)
   not a true protein

7. Species Alvinella pompejana [TaxId:6376] [189859] (1 PDB entry)

8. Domain d2xhfb_: 2xhf B: [170095]
   automated match to d1urma_

Details for d2xhfb_

PDB Entry: 2xhf, 1.3 Å

PDB Description: crystal structure of peroxiredoxin 5 from alvinella pompejana

PDB Compounds: (B:) peroxiredoxin 5

SCOPe Domain Sequences for d2xhfb_:

Sequence; same for both SEQRES and ATOM records:

>d2xhfb_ c.47.1.0 (B:) automated matches {Alvinella pompejana [TaxId: 6376]}
pikvgdiipdvlvyedvpsksfpihdvfrgrkgilfsvvgafvpgsnnhipeylslydkf
keegyhtiaciavndpfvmaawgktvdpehkirmladmhgeftralgteldsskmlgnnr
srryamliddnkirsvstepditglacllsiqrq

Timeline for d2xhfb_:

• d2xhfb_ is new in SCOPe 2.01-stable
  
• d2xhfb_ appears in SCOPe 2.02
  
• d2xhfb_ appears in the current release, SCOPe 2.08