Lineage for d2xhfa1 (2xhf A:37-190)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879017Species Alvinella pompejana [TaxId:6376] [189859] (1 PDB entry)
  8. 2879018Domain d2xhfa1: 2xhf A:37-190 [170094]
    Other proteins in same PDB: d2xhfa2
    automated match to d1urma_

Details for d2xhfa1

PDB Entry: 2xhf (more details), 1.3 Å

PDB Description: crystal structure of peroxiredoxin 5 from alvinella pompejana
PDB Compounds: (A:) peroxiredoxin 5

SCOPe Domain Sequences for d2xhfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xhfa1 c.47.1.0 (A:37-190) automated matches {Alvinella pompejana [TaxId: 6376]}
pikvgdiipdvlvyedvpsksfpihdvfrgrkgilfsvvgafvpgsnnhipeylslydkf
keegyhtiaciavndpfvmaawgktvdpehkirmladmhgeftralgteldsskmlgnnr
srryamliddnkirsvstepditglacllsiqrq

SCOPe Domain Coordinates for d2xhfa1:

Click to download the PDB-style file with coordinates for d2xhfa1.
(The format of our PDB-style files is described here.)

Timeline for d2xhfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2xhfa2
View in 3D
Domains from other chains:
(mouse over for more information)
d2xhfb_