Lineage for d2xhdb_ (2xhd B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2145191Protein automated matches [190140] (30 species)
    not a true protein
  7. 2145279Species Human (Homo sapiens) [TaxId:9606] [189406] (4 PDB entries)
  8. 2145281Domain d2xhdb_: 2xhd B: [170093]
    automated match to d1lbcb_
    complexed with 7t9, glu, so4

Details for d2xhdb_

PDB Entry: 2xhd (more details), 1.8 Å

PDB Description: crystal structure of n-((2s)-5-(6-fluoro-3-pyridinyl)-2,3-dihydro-1h-inden-2-yl)-2-propanesulfonamide in complex with the ligand binding domain of the human glua2 receptor
PDB Compounds: (B:) Glutamate receptor 2

SCOPe Domain Sequences for d2xhdb_:

Sequence, based on SEQRES records: (download)

>d2xhdb_ c.94.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslrtpvnlavlklse
qgvldklknkwwydkgecg

Sequence, based on observed residues (ATOM records): (download)

>d2xhdb_ c.94.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslrtpvnlavlklse
qgvldklknkwwydcg

SCOPe Domain Coordinates for d2xhdb_:

Click to download the PDB-style file with coordinates for d2xhdb_.
(The format of our PDB-style files is described here.)

Timeline for d2xhdb_: