![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
![]() | Protein automated matches [190140] (37 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189406] (17 PDB entries) |
![]() | Domain d2xhdb_: 2xhd B: [170093] automated match to d1lbcb_ complexed with 7t9, glu, so4 |
PDB Entry: 2xhd (more details), 1.8 Å
SCOPe Domain Sequences for d2xhdb_:
Sequence, based on SEQRES records: (download)
>d2xhdb_ c.94.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslrtpvnlavlklse qgvldklknkwwydkgecg
>d2xhdb_ c.94.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslrtpvnlavlklse qgvldklknkwwydcg
Timeline for d2xhdb_: