SCOPe 2.07: Domain d2xhda_: 2xhd A:

Lineage for d2xhda_ (2xhd A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein automated matches [190140] (38 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189406] (19 PDB entries)

8. Domain d2xhda_: 2xhd A: [170092]
   automated match to d1lbcb_
   complexed with 7t9, glu, so4

Details for d2xhda_

PDB Entry: 2xhd, 1.8 Å

PDB Description: crystal structure of n-((2s)-5-(6-fluoro-3-pyridinyl)-2,3-dihydro-1h-inden-2-yl)-2-propanesulfonamide in complex with the ligand binding domain of the human glua2 receptor

PDB Compounds: (A:) Glutamate receptor 2

SCOPe Domain Sequences for d2xhda_:

Sequence; same for both SEQRES and ATOM records:

>d2xhda_ c.94.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslrtpvnlavlkls
eqgvldklknkwwydkgecga

Timeline for d2xhda_:

• d2xhda_ first appeared in SCOPe 2.01
  
• d2xhda_ appears in SCOPe 2.06
  
• d2xhda_ appears in the current release, SCOPe 2.08