Lineage for d2xh5a_ (2xh5 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1042202Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1042203Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1042269Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1043349Protein Pkb kinase (Akt-2) [82791] (1 species)
    AGC group; RAC/Akt subfamily; serine/threonine kinase
  7. 1043350Species Human (Homo sapiens) [TaxId:9606] [82792] (16 PDB entries)
  8. 1043366Domain d2xh5a_: 2xh5 A: [170091]
    automated match to d1o6la_
    complexed with x37

Details for d2xh5a_

PDB Entry: 2xh5 (more details), 2.72 Å

PDB Description: structure of 4-(4-tert-butylbenzyl)-1-(7h-pyrrolo(2,3-d) pyrimidin-4-yl)piperidin-4-amine bound to pkb
PDB Compounds: (A:) rac-beta serine/threonine-protein kinase

SCOPe Domain Sequences for d2xh5a_:

Sequence, based on SEQRES records: (download)

>d2xh5a_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]}
kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq
ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley
lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn
dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll
kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfddefta
qsititppdrydslglleldqreeqemfedfdyiadw

Sequence, based on observed residues (ATOM records): (download)

>d2xh5a_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]}
kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq
ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley
lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn
dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll
kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfddefta
qsitqemfedfdyiadw

SCOPe Domain Coordinates for d2xh5a_:

Click to download the PDB-style file with coordinates for d2xh5a_.
(The format of our PDB-style files is described here.)

Timeline for d2xh5a_: