SCOPe 2.08: Domain d2xgyb_: 2xgy B:

Lineage for d2xgyb_ (2xgy B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein automated matches [190077] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186915] (15 PDB entries)

8. Domain d2xgyb_: 2xgy B: [170088]
   Other proteins in same PDB: d2xgya_
   automated match to d1ak4a_
   complexed with gol

Details for d2xgyb_

PDB Entry: 2xgy, 1.8 Å

PDB Description: complex of rabbit endogenous lentivirus (relik)capsid with cyclophilin a

PDB Compounds: (B:) Peptidyl-prolyl cis-trans isomerase A

SCOPe Domain Sequences for d2xgyb_:

Sequence; same for both SEQRES and ATOM records:

>d2xgyb_ b.62.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

Timeline for d2xgyb_:

• d2xgyb_ first appeared in SCOPe 2.01
  
• d2xgyb_ appears in SCOPe 2.07