Lineage for d2xgyb_ (2xgy B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2397365Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2397366Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2397367Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 protein domains)
    automatically mapped to Pfam PF00160
  6. 2397680Protein automated matches [190077] (19 species)
    not a true protein
  7. 2397702Species Human (Homo sapiens) [TaxId:9606] [186915] (16 PDB entries)
  8. 2397709Domain d2xgyb_: 2xgy B: [170088]
    Other proteins in same PDB: d2xgya_
    automated match to d1ak4a_
    complexed with gol

Details for d2xgyb_

PDB Entry: 2xgy (more details), 1.8 Å

PDB Description: complex of rabbit endogenous lentivirus (relik)capsid with cyclophilin a
PDB Compounds: (B:) Peptidyl-prolyl cis-trans isomerase A

SCOPe Domain Sequences for d2xgyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xgyb_ b.62.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOPe Domain Coordinates for d2xgyb_:

Click to download the PDB-style file with coordinates for d2xgyb_.
(The format of our PDB-style files is described here.)

Timeline for d2xgyb_: