Lineage for d2xfxb_ (2xfx B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 931882Protein beta2-microglobulin [88600] (5 species)
  7. 931883Species Cow (Bos taurus) [TaxId:9913] [48946] (3 PDB entries)
  8. 931884Domain d2xfxb_: 2xfx B: [170087]
    automated match to d1bmga_

Details for d2xfxb_

PDB Entry: 2xfx (more details), 1.9 Å

PDB Description: cattle MHC class I N01301 presenting an 11mer from Theileria parva
PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d2xfxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xfxb_ b.1.1.2 (B:) beta2-microglobulin {Cow (Bos taurus) [TaxId: 9913]}
aiqrppkiqvysrhppedgkpnylncyvygfhppqieidllkngekikseqsdlsfskdw
sfyllshaeftpnskdqyscrvkhvtleqprivkwdrdl

SCOPe Domain Coordinates for d2xfxb_:

Click to download the PDB-style file with coordinates for d2xfxb_.
(The format of our PDB-style files is described here.)

Timeline for d2xfxb_: