Lineage for d2xfab_ (2xfa B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2969655Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2969656Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2969935Family d.109.1.0: automated matches [191561] (1 protein)
    not a true family
  6. 2969936Protein automated matches [190971] (14 species)
    not a true protein
  7. 2970007Species Plasmodium berghei [TaxId:5821] [189993] (1 PDB entry)
  8. 2970009Domain d2xfab_: 2xfa B: [170079]
    automated match to d1f7sa_

Details for d2xfab_

PDB Entry: 2xfa (more details), 2.1 Å

PDB Description: crystal structure of plasmodium berghei actin depolymerization factor 2
PDB Compounds: (B:) actin depolymerization factor 2

SCOPe Domain Sequences for d2xfab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xfab_ d.109.1.0 (B:) automated matches {Plasmodium berghei [TaxId: 5821]}
mvsgvnvsdeciyefnrlkvkhlnkyiiykienlekivvdvlehdmeltsldniimrikn
nlkntecryiiadmpiptpegvlrdriyfifwspglskpkekmlyaaskeslvrkingif
ksleitcdinefeeelkaiilnt

SCOPe Domain Coordinates for d2xfab_:

Click to download the PDB-style file with coordinates for d2xfab_.
(The format of our PDB-style files is described here.)

Timeline for d2xfab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2xfaa_