SCOPe 2.08: Domain d2xfaa_: 2xfa A:

Lineage for d2xfaa_ (2xfa A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families)

5. Family d.109.1.0: automated matches [191561] (1 protein)
   not a true family

6. Protein automated matches [190971] (14 species)
   not a true protein

7. Species Plasmodium berghei [TaxId:5821] [189993] (1 PDB entry)

8. Domain d2xfaa_: 2xfa A: [170078]
   automated match to d1f7sa_

Details for d2xfaa_

PDB Entry: 2xfa, 2.1 Å

PDB Description: crystal structure of plasmodium berghei actin depolymerization factor 2

PDB Compounds: (A:) actin depolymerization factor 2

SCOPe Domain Sequences for d2xfaa_:

Sequence; same for both SEQRES and ATOM records:

>d2xfaa_ d.109.1.0 (A:) automated matches {Plasmodium berghei [TaxId: 5821]}
mvsgvnvsdeciyefnrlkvkhlnkyiiykienlekivvdvlehdmeltsldniimrikn
nlkntecryiiadmpiptpegvlrdriyfifwspglskpkekmlyaaskeslvrkingif
ksleitcdinefeeelkaiilnt

Timeline for d2xfaa_:

• d2xfaa_ first appeared in SCOPe 2.01
  
• d2xfaa_ appears in SCOPe 2.07