Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) |
Family d.109.1.0: automated matches [191561] (1 protein) not a true family |
Protein automated matches [190971] (14 species) not a true protein |
Species Plasmodium berghei [TaxId:5821] [189993] (1 PDB entry) |
Domain d2xfaa_: 2xfa A: [170078] automated match to d1f7sa_ |
PDB Entry: 2xfa (more details), 2.1 Å
SCOPe Domain Sequences for d2xfaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xfaa_ d.109.1.0 (A:) automated matches {Plasmodium berghei [TaxId: 5821]} mvsgvnvsdeciyefnrlkvkhlnkyiiykienlekivvdvlehdmeltsldniimrikn nlkntecryiiadmpiptpegvlrdriyfifwspglskpkekmlyaaskeslvrkingif ksleitcdinefeeelkaiilnt
Timeline for d2xfaa_: