Lineage for d2xe8a_ (2xe8 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910394Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. 2910395Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families) (S)
  5. 2910396Family c.86.1.1: Phosphoglycerate kinase [53749] (2 proteins)
    Domain 2 binds ATP
    automatically mapped to Pfam PF00162
  6. 2910433Protein automated matches [190709] (5 species)
    not a true protein
  7. 2910437Species Human (Homo sapiens) [TaxId:9606] [188478] (25 PDB entries)
  8. 2910446Domain d2xe8a_: 2xe8 A: [170062]
    automated match to d1kf0a_
    complexed with 3pg, acp

Details for d2xe8a_

PDB Entry: 2xe8 (more details), 1.79 Å

PDB Description: the complete reaction cycle of human phosphoglycerate kinase: the open ternary complex with 3pg and amp-pnp
PDB Compounds: (A:) Phosphoglycerate kinase 1

SCOPe Domain Sequences for d2xe8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xe8a_ c.86.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nkltldkldvkgkrvvmrvdfnvpmknnqitnnqrikaavpsikfcldngaksvvlmshl
grpdgvpmpdkyslepvavelksllgkdvlflkdcvgpevekacanpaagsvillenlrf
hveeegkgkdasgnkvkaepakieafraslsklgdvyvndafgtahrahssmvgvnlpqk
aggflmkkelnyfakalesperpflailggakvadkiqlinnmldkvnemiigggmaftf
lkvlnnmeigtslfdeegakivkdlmskaekngvkitlpvdfvtadkfdenaktgqatva
sgipagwmgldcgpesskkyaeavtrakqivwngpvgvfeweafargtkalmdevvkats
rgcitiigggdtatccakwntedkvshvstgggaslellegkvlpgvdalsni

SCOPe Domain Coordinates for d2xe8a_:

Click to download the PDB-style file with coordinates for d2xe8a_.
(The format of our PDB-style files is described here.)

Timeline for d2xe8a_: