Lineage for d2xe7a_ (2xe7 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1388768Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. 1388769Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families) (S)
  5. 1388770Family c.86.1.1: Phosphoglycerate kinase [53749] (2 proteins)
    Domain 2 binds ATP
    automatically mapped to Pfam PF00162
  6. 1388802Protein automated matches [190709] (4 species)
    not a true protein
  7. 1388805Species Human (Homo sapiens) [TaxId:9606] [188478] (18 PDB entries)
  8. 1388824Domain d2xe7a_: 2xe7 A: [170061]
    automated match to d1kf0a_
    complexed with 3pg, adp

Details for d2xe7a_

PDB Entry: 2xe7 (more details), 2.2 Å

PDB Description: the complete reaction cycle of human phosphoglycerate kinase: the open ternary complex with 3pg and adp
PDB Compounds: (A:) Phosphoglycerate kinase 1

SCOPe Domain Sequences for d2xe7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xe7a_ c.86.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nkltldkldvkgkrvvmrvdfnvpmknnqitnnqrikaavpsikfcldngaksvvlmshl
grpdgvpmpdkyslepvavelksllgkdvlflkdcvgpevekacanpaagsvillenlrf
hveeegkgkdasgnkvkaepakieafraslsklgdvyvndafgtahrahssmvgvnlpqk
aggflmkkelnyfakalesperpflailggakvadkiqlinnmldkvnemiigggmaftf
lkvlnnmeigtslfdeegakivkdlmskaekngvkitlpvdfvtadkfdenaktgqatva
sgipagwmgldcgpesskkyaeavtrakqivwngpvgvfeweafargtkalmdevvkats
rgcitiigggdtatccakwntedkvshvstgggaslellegkvlpgvdalsni

SCOPe Domain Coordinates for d2xe7a_:

Click to download the PDB-style file with coordinates for d2xe7a_.
(The format of our PDB-style files is described here.)

Timeline for d2xe7a_: