SCOPe 2.08: Domain d2xe0a_: 2xe0 A:

Lineage for d2xe0a_ (2xe0 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
   alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243

4. Superfamily d.95.2: Homing endonucleases [55608] (3 families)

5. Family d.95.2.1: Group I mobile intron endonuclease [55609] (6 proteins)
   contains two extra helices in the C-terminal extension

6. Protein automated matches [190411] (4 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [187286] (9 PDB entries)

8. Domain d2xe0a_: 2xe0 A: [170046]
   automated match to d1bp7a_
   protein/DNA complex; complexed with act, mg, pgo

Details for d2xe0a_

PDB Entry: 2xe0, 2.31 Å

PDB Description: molecular basis of engineered meganuclease targeting of the endogenous human rag1 locus

PDB Compounds: (A:) I-crei v2v3 variant

SCOPe Domain Sequences for d2xe0a_:

Sequence; same for both SEQRES and ATOM records:

>d2xe0a_ d.95.2.1 (A:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
ntkynkefllylagfvdgdgsiiaqinpnasskfkhrlrltfyvtqktqrrwfldklvde
igvgyvrdsgsvsqyvlseiaplhnfltqlqpflklkqkqanlvlkiieqlpsakaspaa
flevctwvdqiaalndsatrkttsetvaavld

Timeline for d2xe0a_:

• d2xe0a_ first appeared in SCOPe 2.01
  
• d2xe0a_ appears in SCOPe 2.07