Lineage for d2xdea1 (2xde A:1-146)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717816Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2717817Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2717818Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 2718011Protein automated matches [190369] (8 species)
    not a true protein
  7. 2718012Species Human immunodeficiency virus 1 [TaxId:11676] [187207] (7 PDB entries)
  8. 2718014Domain d2xdea1: 2xde A:1-146 [170044]
    Other proteins in same PDB: d2xdea2
    automated match to d1m9xc_
    complexed with 1b0

Details for d2xdea1

PDB Entry: 2xde (more details), 1.4 Å

PDB Description: crystal structure of the complex of pf-3450074 with an engineered hiv capsid n terminal domain
PDB Compounds: (A:) gag polyprotein

SCOPe Domain Sequences for d2xdea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xdea1 a.73.1.1 (A:1-146) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvgeprgsdiagttstlqeqigwmthnppipvgeiy
krwiilglnkivrmys

SCOPe Domain Coordinates for d2xdea1:

Click to download the PDB-style file with coordinates for d2xdea1.
(The format of our PDB-style files is described here.)

Timeline for d2xdea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2xdea2
View in 3D
Domains from other chains:
(mouse over for more information)
d2xdeb_