SCOPe 2.07: Domain d2xdea1: 2xde A:1-146

Lineage for d2xdea1 (2xde A:1-146)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 protein domains)

6. Protein automated matches [190369] (7 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [187207] (7 PDB entries)

8. Domain d2xdea1: 2xde A:1-146 [170044]
   Other proteins in same PDB: d2xdea2
   automated match to d1m9xc_
   complexed with 1b0

Details for d2xdea1

PDB Entry: 2xde, 1.4 Å

PDB Description: Crystal structure of the complex of PF-3450074 with an engineered HIV capsid N terminal domain

PDB Compounds: (A:) gag polyprotein

SCOPe Domain Sequences for d2xdea1:

Sequence; same for both SEQRES and ATOM records:

>d2xdea1 a.73.1.1 (A:1-146) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvgeprgsdiagttstlqeqigwmthnppipvgeiy
krwiilglnkivrmys

Timeline for d2xdea1:

• d2xdea1 first appeared in SCOPe 2.01, called d2xdea_
  
• d2xdea1 appears in SCOPe 2.06