![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
![]() | Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) ![]() |
![]() | Family d.80.1.0: automated matches [191533] (1 protein) not a true family |
![]() | Protein automated matches [190903] (22 species) not a true protein |
![]() | Species Prochlorococcus marinus [TaxId:74547] [189461] (1 PDB entry) |
![]() | Domain d2xcza_: 2xcz A: [170034] automated match to d1mfia_ complexed with peg |
PDB Entry: 2xcz (more details), 1.64 Å
SCOPe Domain Sequences for d2xcza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xcza_ d.80.1.0 (A:) automated matches {Prochlorococcus marinus [TaxId: 74547]} pliniqasvpavadansllqelssklaellgkpekyvmtslqcgvpmtfsgnteptcyve vksigaldgsrtqevselvcghieqnlgipadriyigfedvparlwgwngstfg
Timeline for d2xcza_: