![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.15: HSP20-like chaperones [49763] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) ![]() |
![]() | Family b.15.1.0: automated matches [191643] (1 protein) not a true family |
![]() | Protein automated matches [191181] (7 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [189438] (1 PDB entry) |
![]() | Domain d2xcmc_: 2xcm C: [170032] Other proteins in same PDB: d2xcma1, d2xcma2, d2xcmb1, d2xcmb2 automated match to d1rl1a_ complexed with adp, mg, zn |
PDB Entry: 2xcm (more details), 2.2 Å
SCOPe Domain Sequences for d2xcmc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xcmc_ b.15.1.0 (C:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} akyrheyyqkpeevvvtvfakgipkqnvnidfgeqilsvvievpgedayylqprlfgkii pdkckyevlstkieiclakadiitwaslehgk
Timeline for d2xcmc_: