SCOPe 2.04: Domain d2xcmc_: 2xcm C:

Lineage for d2xcmc_ (2xcm C:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.15.1: HSP20-like chaperones [49764] (5 families)

5. Family b.15.1.0: automated matches [191643] (1 protein)
   not a true family

6. Protein automated matches [191181] (4 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [189438] (1 PDB entry)

8. Domain d2xcmc_: 2xcm C: [170032]
   Other proteins in same PDB: d2xcma_, d2xcmb_
   automated match to d1rl1a_
   complexed with adp, mg, zn

Details for d2xcmc_

PDB Entry: 2xcm, 2.2 Å

PDB Description: complex of hsp90 n-terminal, sgt1 cs and rar1 chord2 domain

PDB Compounds: (C:) sgt1-like protein

SCOPe Domain Sequences for d2xcmc_:

Sequence; same for both SEQRES and ATOM records:

>d2xcmc_ b.15.1.0 (C:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
akyrheyyqkpeevvvtvfakgipkqnvnidfgeqilsvvievpgedayylqprlfgkii
pdkckyevlstkieiclakadiitwaslehgk

Timeline for d2xcmc_:

• d2xcmc_ first appeared in SCOPe 2.01
  
• d2xcmc_ appears in SCOPe 2.03
  
• d2xcmc_ appears in SCOPe 2.05
  
• d2xcmc_ appears in the current release, SCOPe 2.08