SCOPe 2.05: Domain d2xcdb_: 2xcd B:

Lineage for d2xcdb_ (2xcd B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.0: automated matches [191644] (1 protein)
   not a true family

6. Protein automated matches [191182] (12 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [189439] (11 PDB entries)

8. Domain d2xcdb_: 2xcd B: [170021]
   automated match to d1sixa_
   complexed with cl, gol, mg, na

Details for d2xcdb_

PDB Entry: 2xcd, 1.84 Å

PDB Description: Structure of YncF,the genomic dUTPase from Bacillus subtilis

PDB Compounds: (B:) probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf

SCOPe Domain Sequences for d2xcdb_:

Sequence; same for both SEQRES and ATOM records:

>d2xcdb_ b.85.4.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
tmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvv
prsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpa
velvevehl

Timeline for d2xcdb_:

• d2xcdb_ first appeared in SCOPe 2.01
  
• d2xcdb_ appears in SCOPe 2.04
  
• d2xcdb_ appears in SCOPe 2.06
  
• d2xcdb_ appears in the current release, SCOPe 2.08