Lineage for d1b0nb_ (1b0n B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1995641Fold a.34: Dimerisation interlock [47405] (4 superfamilies)
    4 helices; bundle, closed, right-handed twist
  4. 1995642Superfamily a.34.1: SinR repressor dimerisation domain-like [47406] (1 family) (S)
    intertwined heterodimer of two homologous chains
  5. 1995643Family a.34.1.1: SinR repressor dimerisation domain-like [47407] (3 proteins)
  6. 1995644Protein SinI anti-repressor [88843] (1 species)
  7. 1995645Species Bacillus subtilis [TaxId:1423] [88844] (1 PDB entry)
  8. 1995646Domain d1b0nb_: 1b0n B: [17002]
    Other proteins in same PDB: d1b0na1, d1b0na2
    CASP3; complexed with SinR repressor dimerisation domain
    complexed with zn

Details for d1b0nb_

PDB Entry: 1b0n (more details), 1.9 Å

PDB Description: sinr protein/sini protein complex
PDB Compounds: (B:) protein (sini protein)

SCOPe Domain Sequences for d1b0nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0nb_ a.34.1.1 (B:) SinI anti-repressor {Bacillus subtilis [TaxId: 1423]}
feldqewvelmveakeanispeeirkyllln

SCOPe Domain Coordinates for d1b0nb_:

Click to download the PDB-style file with coordinates for d1b0nb_.
(The format of our PDB-style files is described here.)

Timeline for d1b0nb_: