SCOPe 2.01: Domain d2xbta_: 2xbt A:

Lineage for d2xbta_ (2xbt A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.0: automated matches [191610] (1 protein)
   not a true family

6. Protein automated matches [191113] (3 species)
   not a true protein

7. Species Bacteroides cellulosolvens [TaxId:35825] [189900] (1 PDB entry)

8. Domain d2xbta_: 2xbt A: [170004]
   automated match to d1nbca_
   complexed with no3

Details for d2xbta_

PDB Entry: 2xbt, 1.83 Å

PDB Description: Structure of a scaffoldin carbohydrate-binding module family 3b from the cellulosome of Bacteroides cellulosolvens: Structural diversity and implications for carbohydrate binding

PDB Compounds: (A:) cellulosomal scaffoldin

SCOPe Domain Sequences for d2xbta_:

Sequence; same for both SEQRES and ATOM records:

>d2xbta_ b.2.2.0 (A:) automated matches {Bacteroides cellulosolvens [TaxId: 35825]}
pvqvnsdlkllfsnngaaassnqiymnmklqntgsstydlskitiryfytsdddkaltyy
sdyvsigsasatfnnlspvhakankyieiklasgtlgaagaqwpsqsevtiqgrvakadw
tnvdqsndysypgsmsqfgenklvavyyngalvygtpp

Timeline for d2xbta_:

• d2xbta_ is new in SCOPe 2.01-stable
  
• d2xbta_ appears in SCOPe 2.02
  
• d2xbta_ appears in the current release, SCOPe 2.08